PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr8P31170_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 209aa    MW: 23823.4 Da    PI: 8.8121
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr8P31170_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.41e-1753106356
                            --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            k++++++eq++ Le  F +++++   ++ +LA++lgL+ +qV vWFqNrRa++k
  GSMUA_Achr8P31170_001  53 KKRRLSEEQVKLLEMRFGEEKKLELGRKLRLATELGLDPKQVAVWFQNRRARDK 106
                            45689***********************************************99 PP

2HD-ZIP_I/II110.31.4e-3553144293
            HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                            kkrrls+eqvklLE+ F ee+kLe  rK +la+eLgl+p+qvavWFqnrRAR k+kq+E+ y +Lk  ++a + e+++Le+ev +L+ 
  GSMUA_Achr8P31170_001  53 KKRRLSEEQVKLLEMRFGEEKKLELGRKLRLATELGLDPKQVAVWFQNRRARDKSKQVEEAYLKLKPVHEAAVVEKCHLENEVMQLKG 140
                            9**************************************************************************************9 PP

            HD-ZIP_I/II  90 elke 93 
                            +l+e
  GSMUA_Achr8P31170_001 141 KLSE 144
                            9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.98E-1646109IPR009057Homeodomain-like
PROSITE profilePS5007116.34248108IPR001356Homeobox domain
SMARTSM003893.8E-1551112IPR001356Homeobox domain
CDDcd000865.84E-1453109No hitNo description
PfamPF000464.4E-1553106IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.1E-1755113IPR009057Homeodomain-like
PRINTSPR000312.6E-57988IPR000047Helix-turn-helix motif
PROSITE patternPS00027083106IPR017970Homeobox, conserved site
PRINTSPR000312.6E-588104IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MENGGVASES CMIHEEGEMM HFSALSASEL HPQMPRGARR ARRRRKKAKG DAKKRRLSEE  60
QVKLLEMRFG EEKKLELGRK LRLATELGLD PKQVAVWFQN RRARDKSKQV EEAYLKLKPV  120
HEAAVVEKCH LENEVMQLKG KLSEAQEEIR KLSLSMKEAV AGSRPSSSTS SHQPLVADLG  180
VAAEEAELMY IQEFDFGNCM MEWAYFYGL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13846RRARRRRKK
24155RRRRKKAKGDAKKRR
34255RRRKKAKGDAKKRR
44356RRKKAKGDAKKRRL
5100108RRARDKSKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009414757.11e-152PREDICTED: homeobox-leucine zipper protein HOX14
SwissprotQ7XI853e-44HOX14_ORYSJ; Homeobox-leucine zipper protein HOX14
TrEMBLM0TV691e-152M0TV69_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P31170_0011e-151(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP200638101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18550.14e-29homeobox protein 21